AntimicrobialResearch Only

LL-37

Cathelicidin, CAP18, hCAP18

The only human cathelicidin antimicrobial peptide, LL-37 provides broad-spectrum antimicrobial activity and immunomodulatory effects. Key component of innate immunity.

What is LL-37?

LL-37 is a human antimicrobial peptide (AMP) belonging to the cathelicidin family. It is the only cathelicidin found in humans and plays crucial roles in innate immunity, wound healing, and immune modulation. Named for its 37-amino acid length beginning with two leucines, LL-37 is produced by neutrophils, epithelial cells, and other immune cells.

Beyond its antimicrobial properties, LL-37 has attracted research interest for its immunomodulatory effects, wound healing properties, and potential applications in various inflammatory and infectious conditions.


Natural Function

Antimicrobial Activity

LL-37 has broad-spectrum antimicrobial effects:

Active Against:

  • Gram-positive bacteria
  • Gram-negative bacteria
  • Fungi
  • Some viruses
  • Biofilms

Mechanism:

  • Disrupts microbial membranes
  • Creates pores in cell walls
  • Neutralizes endotoxins (LPS)

Immunomodulation

Beyond direct killing:

  • Chemotactic for immune cells
  • Modulates cytokine production
  • Regulates inflammation
  • Promotes wound healing

Molecular Profile

Sequence

[LL-37, 37 aa]

Molecular Data

PropertyValue
Molecular Weight~4493 Da
Amino Acids37
Charge+6 at neutral pH
Structureα-helical in membranes

Research Applications

Wound Healing

LL-37 promotes healing through:

  • Keratinocyte migration
  • Angiogenesis stimulation
  • Anti-biofilm activity
  • Inflammation modulation

Infectious Disease

Research explores:

  • Antibiotic-resistant infections
  • Biofilm-related infections
  • Sepsis models
  • Respiratory infections

Inflammatory Conditions

Studies in:

  • Psoriasis (elevated LL-37)
  • Rosacea (elevated LL-37)
  • Various inflammatory states

Summary

LL-37 represents an important component of human innate immunity with diverse functions beyond simple antimicrobial activity, making it a significant research target.

Key Points:

  • Classification: Human cathelicidin antimicrobial peptide
  • Functions: Antimicrobial, immunomodulatory, wound healing
  • Research: Infectious disease, wound healing, inflammation

Explore more peptides in our comprehensive database

Back to Peptide Database